Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G50310_circ_g.8 |
| ID in PlantcircBase | ath_circ_043395 |
| Alias | AT5G50310_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 20477146-20477609 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, MapSplice, PcircRNA_finder, CIRI-full, CIRI2 |
| Parent gene | AT5G50310 |
| Parent gene annotation |
AT5g50310/MXI22_1 |
| Parent gene strand | + |
| Alternative splicing | AT5G50310_circ_g.2 AT5G50310_circ_g.3 AT5G50310_circ_g.4 AT5G50310_circ_g.5 AT5G50310_circ_g.6 AT5G50310_circ_g.7 |
| Support reads | 2 |
| Tissues | root, leaf, aerial, inflorescences |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G50310.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.413166362 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20477161-20477606(+) |
| Potential amino acid sequence |
MPPSSRAGFSVCVHKKRALLFGGVVDMEMEGDVMMSLFLNELYGFQLDNRRWYPIELRKEKSSK DKVKKIGMPPSSRAGFSVCVHKKRALLFGGVVDMEMEGDVMMSLFLNELYGFQLDNRRWYPIEL RKEKSSKDKVKKIGMPPSSRAGFSVCVHKKRALLFGGVVDMEMEGDVMMSLFLNELYGFQLDNR RWYPIELRKEKSSKDKVKKIGMPPSSRAGFSVCVHKKRALLFGGVVDMEMEGDVMMSLFLNELY GFQLDNRRWYPIELRKEKSSKDK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Liu et al., 2017;Zhang et al., 2019 |