Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G34770_circ_g.2 |
ID in PlantcircBase | ath_circ_016509 |
Alias | AT2G34770_C1, AT2G34770_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 14667693-14667839 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT2G34770 |
Parent gene annotation |
FAH1 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G34770.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.44156302 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14667757-14667836(+) |
Potential amino acid sequence |
MLGYVMYDVTHYYLHHAQPTRPVTKNLKFWNIAKAISTPSTAPALFGGGMLGYVMYDVTHYYLH HAQPTRPVTKNLKFWNIAKAISTPSTAPALFGGGMLGYVMYDVTHYYLHHAQPTRPVTKNLKFW NIAKAISTPSTAPALFGGGMLGYVMYDVTHYYLHHAQPTRPVTKNLK |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |