Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G34770_circ_g.2 |
| ID in PlantcircBase | ath_circ_016509 |
| Alias | AT2G34770_C1, AT2G34770_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 14667693-14667839 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT2G34770 |
| Parent gene annotation |
FAH1 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G34770.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.44156302 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14667757-14667836(+) |
| Potential amino acid sequence |
MLGYVMYDVTHYYLHHAQPTRPVTKNLKFWNIAKAISTPSTAPALFGGGMLGYVMYDVTHYYLH HAQPTRPVTKNLKFWNIAKAISTPSTAPALFGGGMLGYVMYDVTHYYLHHAQPTRPVTKNLKFW NIAKAISTPSTAPALFGGGMLGYVMYDVTHYYLHHAQPTRPVTKNLK |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |