Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0425300_circ_g.1 |
| ID in PlantcircBase | osa_circ_020365 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 17759953-17760117 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0425300 |
| Parent gene annotation |
Similar to DGK1 (DIACYLGLYCEROL KINASE1); calcium ion binding / diacylglycerol kinase. (Os03t0425300-01);Similar to Diacylglycer ol kinase 1 (EC 2.7.1.107) (Diglyceride kinase 1) (DGK 1) (DAG k inase 1). (Os03t0425300-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0425300-01:1 Os03t0425300-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.291412778 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17759993-17760114(+) |
| Potential amino acid sequence |
MGGVDLWKSEDDNPDNFDPQSIHDKMVEVVSISGTWHLGTLQDSEGVLVANIPSYMGGVDLWKS EDDNPDNFDPQSIHDKMVEVVSISGTWHLGTLQDSEGVLVANIPSYMGGVDLWKSEDDNPDNFD PQSIHDKMVEVVSISGTWHLGTLQDSEGVLVANIPSYMGGVDLWKSEDDNPDNFDPQSIHDKMV EVVSISGTWHLGTLQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |