Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0593100_circ_g.3 |
ID in PlantcircBase | osa_circ_029192 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 29550035-29550378 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0593100 |
Parent gene annotation |
Similar to Vacuolar ATP synthase subunit C (EC 3.6.3.14) (V-ATPa se C subunit) (Vacuolar proton pump C subunit). (Os05t0593100-01 ) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0593100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015862 |
PMCS | 0.43825923 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29550135-29550037(-) |
Potential amino acid sequence |
MVTSEHLVTLLAVVPKYSQKDWLSSYESLDTFVVRGAEYNNVRSQLSAINRKQTGSLAVRDLSN LVKPEDMVTSEHLVTLLAVVPKYSQKDWLSSYESLDTFVVRGAEYNNVRSQLSAINRKQTGSLA VRDLSNLVKPEDMVTSEHLVTLLAVVPKYSQKDWLSSYESLDTFVVRGAEYNNVRSQLSAINRK QTGSLAVRDLSNLVKPEDMVTSEHLVTLLAVVPKYSQKDWLSSYESLDTFV(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |