Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0186500_circ_g.4 |
| ID in PlantcircBase | osa_circ_029966 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 4366877-4368596 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0186500 |
| Parent gene annotation |
Similar to predicted protein. (Os06t0186500-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0186500_circ_g.1 Os06g0186500_circ_g.2 Os06g0186500_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0186500-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.122157912 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4367893-4366888(+) 4366941-4368578(-) |
| Potential amino acid sequence |
MRQEYYINRQKTFISHLANQLARHQFLKIACQLERKNIASAYSLLRVIESELQSYLSAVNTRLI CYK*(+) MACCLAFSTCASIHCLSLVANQTGIDS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |