Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G46920_circ_g.3 |
| ID in PlantcircBase | ath_circ_026326 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 17281857-17282009 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT3G46920 |
| Parent gene annotation |
Kinase superfamily with octicosapeptide/Phox/Bem1p domain-contai ning protein |
| Parent gene strand | - |
| Alternative splicing | AT3G46920_circ_g.1 AT3G46920_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G46920.1:1 AT3G46920.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.533110349 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17281860-17281859(-) |
| Potential amino acid sequence |
MIIKDSDLEELRELGSGTFGTVYHGKWRGTDVAIKRINDRCFAGKPSEQERMIIKDSDLEELRE LGSGTFGTVYHGKWRGTDVAIKRINDRCFAGKPSEQERMIIKDSDLEELRELGSGTFGTVYHGK WRGTDVAIKRINDRCFAGKPSEQERM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |