Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0181600_circ_g.2 |
| ID in PlantcircBase | osa_circ_006337 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 5593737-5594167 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os10g0181600 |
| Parent gene annotation |
Methyltransferase type 11 domain containing protein. (Os10t01816 00-01);Similar to CMV 1a interacting protein 1. (Os10t0181600-02 ) |
| Parent gene strand | + |
| Alternative splicing | Os10g0181600_circ_g.3 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0181600-02:2 Os10t0181600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.251022718 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5593962-5593742(+) 5593758-5594082(-) |
| Potential amino acid sequence |
MSIAKRAIPDAGSIEEANQIVRGNWLNAIEEHHLKYSGNCQINDILDIGCSVGVSTRYLAEKFP SARTVII*(+) MEWVQIITVLAEGNFSARYLVLTPTEQPISRMSLI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |