Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA027240_circ_g.5 |
ID in PlantcircBase | osi_circ_007649 |
Alias | 8:13279236|13280179 |
Organism | Oryza sativa ssp. indica |
Position | chr8: 13279236-13280179 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA027240 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA027240_circ_g.1 BGIOSGA027240_circ_g.2 BGIOSGA027240_circ_g.3 BGIOSGA027240_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA027240-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_036610* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13280043-13280141(-) 13279249-13280141(-) |
Potential amino acid sequence |
MMLRINPATVGTGSVQVGPIFSSLTSHRSVLHPRDIDIHVRTTTTKSARRYCECN*(-) MSARQLPNQLGDIVNVTDATTRRNLQNSVVRYGVLIQYLGSLLLELGRTTMMLRINPATVGTGS VQVGPIFSSLTSHRSVLHPRDIDIHVRTTTTKSARRYCECN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |