Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d030184_circ_g.3 |
ID in PlantcircBase | zma_circ_006597 |
Alias | Zm01circ00090, zma_circ_0000235 |
Organism | Zea mays |
Position | chr1: 111906586-111917585 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d030184 |
Parent gene annotation |
CW7 |
Parent gene strand | + |
Alternative splicing | Zm00001d030184_circ_g.1 Zm00001d030184_circ_g.2 Zm00001d030184_circ_g.4 Zm00001d030184_circ_g.5 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d030184_T002:7 Zm00001d030184_T001:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.090739947 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
111907773-111906588(+) 111907314-111917490(-) |
Potential amino acid sequence |
MSCGSAQEKPPKVPLFVTVYFSFVIACRSKFGSFLSLGHDHNKLDRLFMKGPEGRGEVEVAVSG IADQSSGKSKKDPGDSFRVLVHRAASAASKLVKHAYESSSANRQMDDELVPLKCCLMSVSLPWD YIAHDLLHKN*(+) MKIYTARRRVYIFCNLINWRQLFVFHCTVAKIFNSCAKDRGQCSPKEETQTSSNTSEGQAHHPF VC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b |