Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d030184_circ_g.3 |
| ID in PlantcircBase | zma_circ_006597 |
| Alias | Zm01circ00090, zma_circ_0000235 |
| Organism | Zea mays |
| Position | chr1: 111906586-111917585 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d030184 |
| Parent gene annotation |
CW7 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d030184_circ_g.1 Zm00001d030184_circ_g.2 Zm00001d030184_circ_g.4 Zm00001d030184_circ_g.5 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d030184_T002:7 Zm00001d030184_T001:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.090739947 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
111907773-111906588(+) 111907314-111917490(-) |
| Potential amino acid sequence |
MSCGSAQEKPPKVPLFVTVYFSFVIACRSKFGSFLSLGHDHNKLDRLFMKGPEGRGEVEVAVSG IADQSSGKSKKDPGDSFRVLVHRAASAASKLVKHAYESSSANRQMDDELVPLKCCLMSVSLPWD YIAHDLLHKN*(+) MKIYTARRRVYIFCNLINWRQLFVFHCTVAKIFNSCAKDRGQCSPKEETQTSSNTSEGQAHHPF VC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b |