Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0234800_circ_g.4 |
ID in PlantcircBase | osa_circ_014007 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 7631855-7632987 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0234800 |
Parent gene annotation |
Similar to U2 small nuclear ribonucleoprotein A' (U2 snRNP-A'). (Os02t0234800-01) |
Parent gene strand | - |
Alternative splicing | Os02g0234800_circ_g.1 Os02g0234800_circ_g.2 Os02g0234800_circ_g.3 Os02g0234800_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0234800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.140003839 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7632965-7631995(+) 7631916-7632867(-) |
Potential amino acid sequence |
MYVTLARTLDSCDLLRCWSNYFWTLLLHCGILSIHHLSRSKSFGWHLLCLFLCLL*(+) MEEQGPKVVAPTPEQITAIKSSCQSYIHWCLQTIVLQILRRSIPWHLFQSFSFLAYLIIL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |