Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G50210_circ_g.5 |
| ID in PlantcircBase | ath_circ_026797 |
| Alias | Ath_circ_FC5694 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 18615509-18615718 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circRNA_finder |
| Parent gene | AT3G50210 |
| Parent gene annotation |
2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT3G50210_circ_g.1 AT3G50210_circ_g.2 AT3G50210_circ_g.3 AT3G50210_circ_g.4 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G50210.4:2 AT3G50210.1:2 AT3G50210.3:2 AT3G50210.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.174002697 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18615667-18615715(+) |
| Potential amino acid sequence |
MNIWYSFGHIFSNSLISSLVWPFHNFAYIPILPLLNLSVTINGFMNIWYSFGHIFSNSLISSLV WPFHNFAYIPILPLLNLSVTINGFMNIWYSFGHIFSNSLISSLVWPFHNFAYIPILPLLNLSVT INGFMNIWYSFGHIFSNSLIS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |