Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d017261_circ_g.2 |
| ID in PlantcircBase | zma_circ_008752 |
| Alias | zma_circ_0001952, GRMZM2G075683_C1 |
| Organism | Zea mays |
| Position | chr5: 190814829-190815662 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d017261 |
| Parent gene annotation |
Casein kinase 1-like protein 6 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d017261_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d017261_T003:1 Zm00001d017261_T010:2 Zm00001d017261_T021:2 Zm00001d017261_T011:1 Zm00001d017261_T007:2 Zm00001d017261_T015:1 Zm00001d017261_T016:2 Zm00001d017261_T013:2 Zm00001d017261_T005:2 Zm00001d017261_T006:2 Zm00001d017261_T002:2 Zm00001d017261_T012:1 Zm00001d017261_T001:2 Zm00001d017261_T008:2 Zm00001d017261_T009:1 Zm00001d017261_T019:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.093597144 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
190815654-190815638(-) |
| Potential amino acid sequence |
MGVYTSISCCSCEVFVLPVWNVSMSLEVPILLRKAIVNDINLLQDGCLH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |