Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d017261_circ_g.2 |
ID in PlantcircBase | zma_circ_008752 |
Alias | zma_circ_0001952, GRMZM2G075683_C1 |
Organism | Zea mays |
Position | chr5: 190814829-190815662 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d017261 |
Parent gene annotation |
Casein kinase 1-like protein 6 |
Parent gene strand | + |
Alternative splicing | Zm00001d017261_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d017261_T003:1 Zm00001d017261_T010:2 Zm00001d017261_T021:2 Zm00001d017261_T011:1 Zm00001d017261_T007:2 Zm00001d017261_T015:1 Zm00001d017261_T016:2 Zm00001d017261_T013:2 Zm00001d017261_T005:2 Zm00001d017261_T006:2 Zm00001d017261_T002:2 Zm00001d017261_T012:1 Zm00001d017261_T001:2 Zm00001d017261_T008:2 Zm00001d017261_T009:1 Zm00001d017261_T019:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.093597144 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
190815654-190815638(-) |
Potential amino acid sequence |
MGVYTSISCCSCEVFVLPVWNVSMSLEVPILLRKAIVNDINLLQDGCLH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |