Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc11g066560.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003436 |
Alias | 11:49409445|49411550 |
Organism | Solanum lycopersicum |
Position | chr11: 52325945-52328050 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc11g066560.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc11g066560.1.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.153796 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
52327991-52325945(+) 52328010-52326016(+) |
Potential amino acid sequence |
MVKRHLYVQNCCEDHLPHGKGSSYAGGQWAAGDEPLYYIVSPKDVIIAKPRDTEDHINWLLQHG WHEKALEAVEANQGRSELVDEVGSRYLDHLIVERKYGEAASLCPKLLRGSPSAWER*(+) MSKIVARITFRMGKVAAMQGVSGLLVMNPYTTLCPQKM*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Yin et al., 2018 |