Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0421400_circ_g.2 |
| ID in PlantcircBase | osa_circ_020337 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 17553618-17554096 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0421400 |
| Parent gene annotation |
Similar to band 7 family protein. (Os03t0421400-01);Similar to b and 7 family protein. (Os03t0421400-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0421400_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0421400-02:3 Os03t0421400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.20043603 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17554072-17553862(+) 17553643-17553640(-) |
| Potential amino acid sequence |
MLDGAENEISILSKLIMTPPFVPQGIFLPGLFEE*(+) MISFDKIEISFSAPSSILHQVPEGHVGVYWRGGALLETITPPGFHVKLPWITQFEPIQVTLQTD QAKIFLVEQKVES*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |