Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0682800_circ_g.1 |
| ID in PlantcircBase | osa_circ_032075 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 28458971-28459167 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0682800 |
| Parent gene annotation |
Zinc finger, CCCH-type domain containing protein. (Os06t0682800- 01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0682800_circ_g.2 Os06g0682800_circ_g.3 Os06g0682800_circ_g.4 Os06g0682800_circ_g.5 Os06g0682800_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0682850-00:1 Os06t0682800-01:1 Os06t0682850-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.220507614 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28459031-28459145(-) 28459131-28459098(-) |
| Potential amino acid sequence |
MVTTMRKEMLFLLQMFLQIGEEKEREL*(-) MSEKYRPEDALEPFQSSKGTEAKELLSVKKNLGDGDNNEKGNVVSSANVFTDRGRKGERVMTTG ILCQRNIDQKML*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |