Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0771350_circ_g.6 |
ID in PlantcircBase | osa_circ_004089 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 32564746-32565824 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0771400 |
Parent gene annotation |
Similar to CM0545.290.nc protein. (Os01t0771400-00) |
Parent gene strand | - |
Alternative splicing | Os01g0771350_circ_g.3 Os01g0771350_circ_g.4 Os01g0771350_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0771350-01:2 Os01t0771400-00:2 Os01t0771350-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.24896028 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32565811-32565769(-) 32564811-32565798(-) |
Potential amino acid sequence |
MLFIDFPPVLQVQLKRFEYDFVRDTMVKINDRYEFPLQLDLDKDDGKYLSPEADRRVRNLYTLH RMPRKGCFLLTSLQSCKFN*(-) MMENTSLQKLTGGCVTSILYTGCQERDAFY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |