Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0366300_circ_g.1 |
| ID in PlantcircBase | osa_circ_027654 |
| Alias | Os_ciR9840 |
| Organism | Oryza sativa |
| Position | chr5: 17585231-17585665 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0366300 |
| Parent gene annotation |
Conserved hypothetical protein. (Os05t0366300-01);Hypothetical c onserved gene. (Os05t0366300-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0365700_circ_ag.1 Os05g0365700_circ_ag.2 Os05g0365700_circ_ag.3 Os05g0365700_circ_ag.4 Os05g0365700_circ_g.1 Os05g0365700_circ_ag.2 EPlOSAG00000034967_circ_ig.1 Os05g0366200_circ_ig.1 Os05g0366600_circ_g.1 Os05g0366600_circ_g.2 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0366300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.286547893 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17585278-17585241(+) 17585495-17585245(+) |
| Potential amino acid sequence |
MWRCQWLELRMKDLQSQVSRYDRQLAVLKHEKELQTKMIELDCSSSRSVPFSSHCCRKTMKRRR RKRNEEKMNASSYISNHTVFSYYEKTEADAFSIDDDEDTGRNG*(+) MLHRTSQITLYSLIMRKRKQMPFLLMTMRTQEETGN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |