Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0409700_circ_g.2 |
| ID in PlantcircBase | osa_circ_033480 |
| Alias | Os_ciR10870 |
| Organism | Oryza sativa |
| Position | chr7: 12786362-12788208 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0409700 |
| Parent gene annotation |
Mitochondrial import inner membrane translocase, subunit Tim44 f amily protein. (Os07t0409700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0409700-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.14220568 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12788186-12787291(+) |
| Potential amino acid sequence |
MDFWNSGLLGICSKNRFNHFLNITSKIRQRKGWVSLPNFPERHCSCGFLKNRFIQILNFLNHWI VTCLPPLSYILSYLLSYVDDWFGIFIHSLIGWMTSHLILKCFPLFTQY*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |