Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0186600_circ_g.4 |
ID in PlantcircBase | osa_circ_029969 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 4373335-4373695 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0186600 |
Parent gene annotation |
Conserved hypothetical protein. (Os06t0186600-01);Similar to pre dicted protein. (Os06t0186600-02) |
Parent gene strand | - |
Alternative splicing | Os06g0186600_circ_g.1 Os06g0186600_circ_g.2 Os06g0186600_circ_g.3 Os06g0186600_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0186600-02:2 Os06t0186600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.509125646 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4373344-4373610(-) |
Potential amino acid sequence |
MNSIYHGMKVIWWQNVTSQNISLYGKFWKVV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |