Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G57800_circ_g.1 |
| ID in PlantcircBase | ath_circ_028049 |
| Alias | AT3G57800_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 21409007-21409295 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, CIRI2 |
| Parent gene | AT3G57800 |
| Parent gene annotation |
Transcription factor bHLH60 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G57800.2:2 AT3G57800.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.40712738 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21409079-21409009(-) |
| Potential amino acid sequence |
MLSMRLAAVNPRIDFNLDTILASEIQGTALVLDEIINHVQSLQRQVEMLSMRLAAVNPRIDFNL DTILASEIQGTALVLDEIINHVQSLQRQVEMLSMRLAAVNPRIDFNLDTILASEIQGTALVLDE IINHVQSLQRQVEMLSMRLAAVNPRIDFNLDTILASE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |