Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G55510_circ_g.3 |
| ID in PlantcircBase | ath_circ_007531 |
| Alias | Ath_circ_FC0789, AT1G55510_C1, CircBCDH BETA1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 20724108-20724717 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, CIRI2 |
| Parent gene | AT1G55510 |
| Parent gene annotation |
2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial |
| Parent gene strand | + |
| Alternative splicing | AT1G55510_circ_g.2 AT1G55510_circ_g.4 AT1G55510_circ_g.5 AT1G55510_circ_g.6 |
| Support reads | 2 |
| Tissues | root, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G55510.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.25925593 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20724694-20724714(+) |
| Potential amino acid sequence |
MIPLSEAEGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHY HSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCIRDPNPVVFFEPKWLYRQAVEEVPEHDYMIP LSEAEGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQ SPEAFFCHVPGIKVVIPRSPREAKGLLLSCIRDPNPVVFFEPKWLYRQAVEEVPEHDYMIPLSE AEGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPE AFFCHVPGIKVVIPRSPREAKGLLLSCIRDPNPVVFFEPKWLYRQAVEEVPEHDYMIPLSEAE( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |