Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014863_circ_g.2 |
ID in PlantcircBase | zma_circ_008515 |
Alias | Zm05circ00051, GRMZM2G145041_C1 |
Organism | Zea mays |
Position | chr5: 66026641-66027125 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d014863 |
Parent gene annotation |
Protein REVEILLE 7 |
Parent gene strand | - |
Alternative splicing | Zm00001d014863_circ_g.1 Zm00001d014863_circ_g.3 Zm00001d014863_circ_g.4 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d014863_T001:3 Zm00001d014863_T002:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.213364966 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
66026817-66026824(-) |
Potential amino acid sequence |
MVGLGARYKNTLAQRLLSRFGAMLRSFSPRKGTRWIHLPCRLTKGCGRMLSNHPWWMMQRNPRR GRTVTLSRFGSLTRSRSSERSGQRKSMGSSWRH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |