Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G54010_circ_g.3 |
| ID in PlantcircBase | ath_circ_027389 |
| Alias | At_ciR5901 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 20004186-20004458 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT3G54010 |
| Parent gene annotation |
Peptidyl-prolyl cis-trans isomerase PASTICCINO1 |
| Parent gene strand | + |
| Alternative splicing | AT3G54010_circ_g.2 AT3G54010_circ_g.4 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G54010.2:2 AT3G54010.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.179986935 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20004189-20004455(+) |
| Potential amino acid sequence |
MLHLNVAACLLKMGEWRKSIETCNKVLEAKPGHVKGLYRRGMAYIAGGEYDDARNDFNMNMLHL NVAACLLKMGEWRKSIETCNKVLEAKPGHVKGLYRRGMAYIAGGEYDDARNDFNMNMLHLNVAA CLLKMGEWRKSIETCNKVLEAKPGHVKGLYRRGMAYIAGGEYDDARNDFNMNMLHLNVAACLLK MGEWRKSIETCNKVLEAKPGHVKGLYRRGMAYIAGGEYDDARNDFNM(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |