Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G290800_circ_g.3 |
| ID in PlantcircBase | gra_circ_000899 |
| Alias | Chr08:56527649|56528813 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 56527649-56528813 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G290800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.008G290800_circ_g.1 orai.008G290800_circ_g.2 |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.008G290800.1:4 Gorai.008G290800.2:4 Gorai.008G290800.3:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.117358555 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
56528397-56528808(-) |
| Potential amino acid sequence |
MLKASDSSTPNDKCSLRSLEQVQAELFEKQICGGLKLSIFQYSMVLFWQGGHEEK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |