Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G19715_circ_g.5 |
| ID in PlantcircBase | ath_circ_003446 |
| Alias | At_ciR1134 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 6819110-6819313 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ, CIRI-full |
| Parent gene | AT1G19715 |
| Parent gene annotation |
Jacalin-related lectin 3 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 5/1 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G19715.2:1 AT1G19715.1:1 AT1G19715.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.446255657 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6819245-6819112(-) |
| Potential amino acid sequence |
MYTTVKQIIIAHGSGIDSIQIEYDKNGSSVWSEKRGGKGGKKFDKSVEGKPASLGPWGGQSGHA WDDGMYTTVKQIIIAHGSGIDSIQIEYDKNGSSVWSEKRGGKGGKKFDKSVEGKPASLGPWGGQ SGHAWDDGMYTTVKQIIIAHGSGIDSIQIEYDKNGSSVWSEKRGGKGGKKFDKSVEGKPASLGP WGGQSGHAWDDGMYTTVKQIIIAHGSGIDSIQIEYDKNGSSVWSEKRGGKGGKKFDK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |