Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0140400_circ_g.1 |
ID in PlantcircBase | osa_circ_000260 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 2132847-2133944 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0140400 |
Parent gene annotation |
Similar to leucine-rich repeat protein-related. (Os01t0140400-01 );Leucine-rich repeat, N-terminal domain containing protein. (Os 01t0140400-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0140400-02:2 Os01t0140400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.229880844 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2132856-2133908(+) 2132941-2133923(-) |
Potential amino acid sequence |
MKALKDSLKIPARMGWNGDPCAPRTWDAWEGVTCLRKDKGLVITQLDLASQGLKGYITDEISHL TDLVSFGCNEGIEGFPENSSKDGVEWGSMCTKDMGCMGGSHLPPQGQRACDHPTGSCKSRTKRL HH*(+) MHPMSLVHMDPHSTPSLLEFSGNPSMPSLQPKLTKSVR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |