Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA029261_circ_g.5 |
| ID in PlantcircBase | osi_circ_008235 |
| Alias | 9:21292505|21293247 |
| Organism | Oryza sativa ssp. indica |
| Position | chr9: 21292505-21293247 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA029261 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA029261_circ_g.1 BGIOSGA029261_circ_g.2 BGIOSGA029261_circ_g.3 BGIOSGA029261_circ_g.4 BGIOSGA029261_circ_g.6 BGIOSGA029261_circ_g.7 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA029261-TA:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21293223-21293220(-) 21292910-21292527(+) |
| Potential amino acid sequence |
MIWKGSDEKTVGETLYPPILHPVIATPLQMKMVDDPALSNVVGRASKMIGNFMSYYTHLPHEAT KGKMTFLLHGPCDKKAVVEGIGRTLGLPVASVDASSLIKDFPSDSVSQINTCIQRPESRDGPLL IFLDRFDELVPHNRCGSTVMTDITTTQDKLPQGPRS*(-) MKLPIILLALPTTLERAGSSTIFICRGVAMTGCKIGGYRVSPTVFSSLPFQIMILVPEVICPGW LLCQS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |