Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0477000_circ_g.1 |
ID in PlantcircBase | osa_circ_007114 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 17779757-17780936 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0477000 |
Parent gene annotation |
Armadillo-like helical domain containing protein. (Os10t0477000- 01) |
Parent gene strand | + |
Alternative splicing | Os10g0477000_circ_g.2 Os10g0477000_circ_g.3 Os10g0477000_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0477000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.121191949 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17780853-17779773(+) |
Potential amino acid sequence |
MLWSMQVPRKVMCKQKFLPWQLDYSKEADAHESS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |