Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0173500_circ_g.1 |
| ID in PlantcircBase | osa_circ_026833 |
| Alias | Os_ciR10223 |
| Organism | Oryza sativa |
| Position | chr5: 4405709-4407009 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0173500 |
| Parent gene annotation |
Conserved hypothetical protein. (Os05t0173500-01);Hypothetical c onserved gene. (Os05t0173500-02);Hypothetical conserved gene. (O s05t0173500-03) |
| Parent gene strand | + |
| Alternative splicing | Os05g0173500_circ_g.2 Os05g0173500_circ_g.3 Os05g0173500_circ_g.4 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0173500-01:8 Os05t0173500-02:8 Os05t0173500-03:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.310649761 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4406409-4405710(+) 4405774-4406959(-) |
| Potential amino acid sequence |
MNFREALLEVYREDMFPVRKNGIKYELDNTQLRFKSMKEKYDAHVACLDESVPEDEVRQLIKEA VIKMKPKPHTYLDYARKKLQISMNIDLITKS*(+) MLDHPHRYYNLSGNAPTLRTQLLVIKSIFIDICNFFLA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |