Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0109900_circ_g.2 |
| ID in PlantcircBase | osa_circ_035589 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 514914-516844 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0109900 |
| Parent gene annotation |
Similar to Nucleic acid binding protein. (Os08t0109900-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0109900_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0109900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.137836825 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
516753-514955(+) 515017-516706(-) 514932-516765(-) |
| Potential amino acid sequence |
MQDTHLLKFLFHIKVFRNSRIIVFLLDNLPNHILRIIWIDTEFGG*(+) MAIKRKIEQAATSDFQMRSLPTKLRIDPNDPEDVVRKIIKEKNDDPGISEYLDMEKELQEVSIL HVVCYAAVYFVLLGIN*(-) MIRRMWLGRLSRRKTMILEFLNTLIWKRNFKR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |