Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0547500_circ_g.7 |
| ID in PlantcircBase | osa_circ_037953 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 27440306-27441476 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0547550 |
| Parent gene annotation |
Hypothetical protein. (Os08t0547550-00) |
| Parent gene strand | + |
| Alternative splicing | Os08g0547500_circ_g.2 Os08g0547500_circ_g.3 Os08g0547500_circ_g.4 Os08g0547500_circ_g.5 Os08g0547500_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0547500-02:7 Os08t0547500-01:7 Os08t0547550-00:6 Os08t0547500-02:7 Os08t0547500-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.214544841 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27441239-27441475(-) |
| Potential amino acid sequence |
MTGITEYSVLDIYDYIEKHPEREFILRFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTVEKL TEETLRDKDHLRNLLAVCEAQRQIGETALNETSSRSHQILRLTIESSTRQYLGRGNSSTLVACV NFVDLAGSERASQTASAGVRLKEGSHINRSLLTLGKVVRQLR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |