Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0547500_circ_g.7 |
ID in PlantcircBase | osa_circ_037953 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 27440306-27441476 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0547550 |
Parent gene annotation |
Hypothetical protein. (Os08t0547550-00) |
Parent gene strand | + |
Alternative splicing | Os08g0547500_circ_g.2 Os08g0547500_circ_g.3 Os08g0547500_circ_g.4 Os08g0547500_circ_g.5 Os08g0547500_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0547500-02:7 Os08t0547500-01:7 Os08t0547550-00:6 Os08t0547500-02:7 Os08t0547500-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.214544841 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27441239-27441475(-) |
Potential amino acid sequence |
MTGITEYSVLDIYDYIEKHPEREFILRFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTVEKL TEETLRDKDHLRNLLAVCEAQRQIGETALNETSSRSHQILRLTIESSTRQYLGRGNSSTLVACV NFVDLAGSERASQTASAGVRLKEGSHINRSLLTLGKVVRQLR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |