Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G36990_circ_g.2 |
ID in PlantcircBase | ath_circ_016978 |
Alias | AT2G36990_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 15538458-15538688 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, CIRI2 |
Parent gene | AT2G36990 |
Parent gene annotation |
RNA polymerase sigma factor sigF, chloroplastic |
Parent gene strand | - |
Alternative splicing | AT2G36990_circ_g.3 AT2G36990_circ_g.4 |
Support reads | 39 |
Tissues | whole_plant, leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G36990.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.275901952 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15538605-15538460(-) |
Potential amino acid sequence |
MGISSPVLKSDIHRGRSSREKLITANLRLVVHIAKQYQNRGLNFQDLLQHLLKLEKVKTKLESQ NGCEPTIGEWAEAMGISSPVLKSDIHRGRSSREKLITANLRLVVHIAKQYQNRGLNFQDLLQHL LKLEKVKTKLESQNGCEPTIGEWAEAMGISSPVLKSDIHRGRSSREKLITANLRLVVHIAKQYQ NRGLNFQDLLQHLLKLEKVKTKLESQNGCEPTIGEWAEAMGISSPVLKSDIHRGRSSREKLITA NLRLVVHIAKQYQNRGLNFQDLLQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Zhang et al., 2019 |