Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0929200_circ_g.1 |
| ID in PlantcircBase | osa_circ_005650 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 40787639-40790347 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0929200 |
| Parent gene annotation |
Serine/threonine protein kinase domain containing protein. (Os01 t0929200-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0929200_circ_g.2 Os01g0929200_circ_g.3 Os01g0929200_circ_g.4 Os01g0929200_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0929200-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.119442697 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40790198-40787673(+) 40788892-40790310(-) |
| Potential amino acid sequence |
MMQTTNLFLSVLEFAFLISLSLSPQSLPLSQPLAPIISKEAEATPTWFRRTGIKERIVRCSR*( +) MSAILAASLAGAAGFLALVGAAIFLIVLFLRHRRRASDSSESSSSSPAQPELQGARCMTLEELS SATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLG YCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHM NFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPSSPEPSRCCFCFL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |