Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0958500_circ_g.1 |
| ID in PlantcircBase | osa_circ_005892 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 42248756-42250080 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0958500 |
| Parent gene annotation |
Similar to RNA binding protein-like. (Os01t0958500-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0958500_circ_g.2 Os01g0958500_circ_g.3 Os01g0958500_circ_g.4 Os01g0958500_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0958500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.214908384 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42248784-42248783(+) 42250042-42248796(+) 42250044-42250068(-) |
| Potential amino acid sequence |
MKACFDPYPVIDGRRANCNLAYLGVQRSKAAAASLQPYAGHMRAMKSIIQTGGGGASLSMADHG IQQGIPTYNVYGLHSASRRLL*(+) MASSRGSRPTMCMGYIPRAGGCYESLL*(+) MICHAQAGTTTACLDNGLHCPHMPSIRLQRRCSCLGSLDPKICKIAVGPPPIDHRVRIKASFHS SLRLAECNPYTL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |