Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0209700_circ_g.2 |
| ID in PlantcircBase | osa_circ_006437 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 7779642-7779795 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os10g0209700 |
| Parent gene annotation |
Heavy metal transport/detoxification protein domain containing p rotein. (Os10t0209700-01) |
| Parent gene strand | + |
| Alternative splicing | Os10g0209700_circ_g.3 Os10g0209700_circ_g.4 Os10g0209700_circ_g.5 Os10g0209700_circ_g.6 |
| Support reads | 3 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0209700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.284307359 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7779742-7779673(+) 7779744-7779647(-) |
| Potential amino acid sequence |
MHCEGCAKKVEKSLLRFEGTKGVCERRAG*(+) MSTFSTISCGSSGFSLAASSFFSACSSFTDSFSSFKSQEGFLDLLCTSFAVHVDFQYDLLWFIW LLLGCLLLFLSLLFFHRLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |