Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0465900_circ_g.5 |
| ID in PlantcircBase | osa_circ_014611 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 15678659-15678735 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0465900 |
| Parent gene annotation |
ChaC-like protein family protein. (Os02t0465900-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0465900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.083333333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15678705-15678732(+) 15678664-15678728(-) |
| Potential amino acid sequence |
MLRRAPMVNARHMASSSDSSVQVLAGCSGVPRWSMQGIWLPRRTQVCRSSQDAPACPDGQCKAY GFLVGLKCAGPRRMLRRAPMVNA(+) MPCIDHRGTPEHPARTCTLESDEEAICLALTIGARRSILRGPAHLSPTRKPYALH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |