Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0244100_circ_g.1 |
ID in PlantcircBase | osa_circ_014045 |
Alias | Os_ciR8380 |
Organism | Oryza sativa |
Position | chr2: 8117431-8117788 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0244100 |
Parent gene annotation |
RING-type E3 ubiquitin ligase, Regulation of grain width and wei ght (Os02t0244100-01) |
Parent gene strand | + |
Alternative splicing | Os02g0244100_circ_g.2 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0244100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.208794227 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8117459-8117446(+) |
Potential amino acid sequence |
MRMRQQALQDEEDKMKRKQNRCSSSRTITPTKEVEYRDICSTSFSVPSYRCAEQETECCSSEPS CSAQTSMRPFHSRHNRKSRKS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |