Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0015s05550_circ_g.1 |
| ID in PlantcircBase | pop_circ_003656 |
| Alias | Chr15:2348111-2349413 |
| Organism | Populus trichocarpa |
| Position | chr15: 5880048-5881350 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0015s05550 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | POPTR_0015s05550_circ_g.2 |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | POPTR_0015s05550.1:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.171530155 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5881294-5880052(+) 5881325-5880286(+) 5881011-5881305(-) |
| Potential amino acid sequence |
MVQISTSSKFDDNFEFPLSPA*(+) MTTLNSLSLLHDISFPFLRTLASHLQQRSDLSFIQSFGVPLTLNNLTNLHRQIVRSLLISHL*( +) MGLSLNIDMSSTAFIEPLPVIDFVTQLLNRDVSSRPLSDSDRIKIKKALRGVRVEVTHRGNMRR KYRISGLTSQATRELTFPVDERGTLKSVVEYFYETYGFVIQHTQWPCLQVGNQQRPNYLPMEVC KIVEGQRYSKRLNERQITALLKVTCQRPQERERDIMQEREGIQSCHQICCSC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |