Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G61660_circ_g.4 |
| ID in PlantcircBase | ath_circ_008354 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 22754964-22755029 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G61660 |
| Parent gene annotation |
Transcription factor bHLH112 |
| Parent gene strand | - |
| Alternative splicing | 1_circ_ag.6 AT1G61660_circ_g.1 AT1G61660_circ_g.2 AT1G61660_circ_g.3 AT1G61660_circ_g.5 AT1G61660_circ_g.6 AT1G61660_circ_g.7 AT1G61690_circ_g.1 AT1G61690_circ_g.2 AT1G61690_circ_g.3 AT1G61720_circ_g.1 AT1G61740_circ_g.1 AT1G61740_circ_g.2 AT1G61740_circ_g.3 AT1G61770_circ_g.1 AT1G61770_circ_g.2 AT1G61780_circ_g.1 AT1G61790_circ_g.1 AT1G61800_circ_g.1 AT1G61800_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G61660.3:1 AT1G61660.6:1 AT1G61660.5:1 AT1G61660.1:1 AT1G61660.2:1 AT1G61660.7:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.18939015 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22754993-22755026(+) |
| Potential amino acid sequence |
MKLSGPLDSLFSPFRKVKLVVVMKLSGPLDSLFSPFRKVKLVVVMKLSGPLDSLFSPFRKVKLV VVMKLSGPLDSLFS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |