Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0779100_circ_g.1 |
ID in PlantcircBase | osa_circ_004205 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 32988416-32989994 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0779100 |
Parent gene annotation |
Peptidase M16, zinc-binding site domain containing protein. (Os0 1t0779100-00) |
Parent gene strand | + |
Alternative splicing | Os01g0778800_circ_g.1 Os01g0778800_circ_ag.1 Os01g0778800_circ_ag.2 Os01g0778800_circ_ag.3 Os01g0778800_circ_ag.4 Os01g0778800_circ_ag.5 Os01g0778800_circ_ag.6 Os01g0778800_circ_ag.7 Os01g0778800_circ_ag.8 Os01g0778800_circ_ag.9 Os01g0778800_circ_g.10 Os01g0778800_circ_ag.11 Os01g0778800_circ_ag.12 Os01g0778800_circ_g.13 Os01g0778800_circ_ag.14 Os01g0778800_circ_ag.15 Os01g0778800_circ_ag.16 Os01g0778800_circ_ag.17 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0779100-00:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.419529949 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32988877-32988455(+) |
Potential amino acid sequence |
MISEHMEDIIGLVFKYILLLKENGIHEWIYDELVAINETEFHYQDKVHPISYVTDIVTTMRSFP PEEWLVGASLPSKYAPNRINMILDELSAERVSLLSKLSRYLKAIT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |