Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0779100_circ_g.1 |
| ID in PlantcircBase | osa_circ_004205 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 32988416-32989994 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0779100 |
| Parent gene annotation |
Peptidase M16, zinc-binding site domain containing protein. (Os0 1t0779100-00) |
| Parent gene strand | + |
| Alternative splicing | Os01g0778800_circ_g.1 Os01g0778800_circ_ag.1 Os01g0778800_circ_ag.2 Os01g0778800_circ_ag.3 Os01g0778800_circ_ag.4 Os01g0778800_circ_ag.5 Os01g0778800_circ_ag.6 Os01g0778800_circ_ag.7 Os01g0778800_circ_ag.8 Os01g0778800_circ_ag.9 Os01g0778800_circ_g.10 Os01g0778800_circ_ag.11 Os01g0778800_circ_ag.12 Os01g0778800_circ_g.13 Os01g0778800_circ_ag.14 Os01g0778800_circ_ag.15 Os01g0778800_circ_ag.16 Os01g0778800_circ_ag.17 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0779100-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.419529949 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32988877-32988455(+) |
| Potential amino acid sequence |
MISEHMEDIIGLVFKYILLLKENGIHEWIYDELVAINETEFHYQDKVHPISYVTDIVTTMRSFP PEEWLVGASLPSKYAPNRINMILDELSAERVSLLSKLSRYLKAIT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |