Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G77620_circ_g.2 |
ID in PlantcircBase | ath_circ_010662 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 29172434-29172580 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G77620 |
Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G77620.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.130385486 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29172500-29172436(-) |
Potential amino acid sequence |
MIAANVSPPVPNLRLEAKLRAEVAKGKSPRKTTPKKCATKNGIVAAGDQMIAANVSPPVPNLRL EAKLRAEVAKGKSPRKTTPKKCATKNGIVAAGDQMIAANVSPPVPNLRLEAKLRAEVAKGKSPR KTTPKKCATKNGIVAAGDQMIAANVSPPVPNLRLEAKLRAE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |