Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G27350_circ_g.2 |
| ID in PlantcircBase | ath_circ_040718 |
| Alias | At_ciR1186, AT5G27350_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 9650451-9651089 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | MapSplice, find_circ, CIRI2 |
| Parent gene | AT5G27350 |
| Parent gene annotation |
Sugar transporter ERD6-like 17 |
| Parent gene strand | + |
| Alternative splicing | AT5G27350_circ_g.1 AT5G27350_circ_g.3 AT5G27350_circ_g.4 AT5G27350_circ_g.5 5_circ_ag.6 AT5G27350_circ_g.7 AT5G27350_circ_g.8 AT5G27350_circ_g.9 AT5G27350_circ_g.10 AT5G27350_circ_g.11 AT5G27350_circ_g.12 AT5G27350_circ_g.13 5_circ_ag.14 AT5G27350_circ_g.15 5_circ_ag.16 AT5G27350_circ_g.17 5_circ_ag.18 AT5G27350_circ_g.19 AT5G27360_circ_g.1 AT5G27360_circ_g.2 AT5G27360_circ_g.3 AT5G27360_circ_g.4 AT5G27360_circ_g.5 AT5G27360_circ_g.6 |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G27350.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.171004708 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9650520-9651086(+) |
| Potential amino acid sequence |
MVIGRRGTMWVSDFLCITGWLSIAFAKEVVLLNFGRIISGIGFGLTSYVVPVYIAEITPKHVRG TFTFSNQFSAFGSFATLGAAIGALFCGNLAMVIGRRGTMWVSDFLCITGWLSIAFAKEVVLLNF GRIISGIGFGLTSYVVPVYIAEITPKHVRGTFTFSNQFSAFGSFATLGAAIGALFCGNLAMVIG RRGTMWVSDFLCITGWLSIAFAKEVVLLNFGRIISGIGFGLTSYVVPVYIAEITPKHVRGTFTF SNQFSAFGSFATLGAAIGALFCGNLAMVIGRRGTMWVSDFLCITGWLSIAFAKEVVLLNFGRII SGIGFGLTSYVVPVYIAEITPKHVRGTFTFSNQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Liu et al., 2017;Zhang et al., 2019 |