Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d049958_circ_g.1 |
| ID in PlantcircBase | zma_circ_008027 |
| Alias | zma_circ_0001798 |
| Organism | Zea mays |
| Position | chr4: 55682308-55684198 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d049958 |
| Parent gene annotation |
Putative peptidyl-prolyl cis-trans isomerase and WD40 repeat dom ain family protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d049958_T001:6 Zm00001d049958_T004:6 Zm00001d049958_T005:6 Zm00001d049958_T003:6 Zm00001d049958_T002:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.067205949 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
55684135-55682329(+) 55683867-55684192(-) |
| Potential amino acid sequence |
MRPKMFSKFNPNRFLLPKLQMPFTPKRVA*(+) MMFMIRLSFVPGAIEWVHREGDVKPKLAVSDRNTPFVHIFDTHSGSNDPIMSKEIHGGPVKVMK YNHIHDVVISADAKGLLEYWSPSTLMFPENEVRFRLKSDTNLFEIAKCKTTVSAIEVSNDGTQF AVTSPDRRIRVFWFKTGKLRRVYDESLDVAQDLQRSDVPLYHLDAIDFGRRMAVEKEIEKTENV PQPNAVFDESCNFLIYATLLGVKGI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |