Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d049958_circ_g.1 |
ID in PlantcircBase | zma_circ_008027 |
Alias | zma_circ_0001798 |
Organism | Zea mays |
Position | chr4: 55682308-55684198 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d049958 |
Parent gene annotation |
Putative peptidyl-prolyl cis-trans isomerase and WD40 repeat dom ain family protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d049958_T001:6 Zm00001d049958_T004:6 Zm00001d049958_T005:6 Zm00001d049958_T003:6 Zm00001d049958_T002:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.067205949 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
55684135-55682329(+) 55683867-55684192(-) |
Potential amino acid sequence |
MRPKMFSKFNPNRFLLPKLQMPFTPKRVA*(+) MMFMIRLSFVPGAIEWVHREGDVKPKLAVSDRNTPFVHIFDTHSGSNDPIMSKEIHGGPVKVMK YNHIHDVVISADAKGLLEYWSPSTLMFPENEVRFRLKSDTNLFEIAKCKTTVSAIEVSNDGTQF AVTSPDRRIRVFWFKTGKLRRVYDESLDVAQDLQRSDVPLYHLDAIDFGRRMAVEKEIEKTENV PQPNAVFDESCNFLIYATLLGVKGI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |