Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Bra003840_circ_g.1 |
| ID in PlantcircBase | bra_circ_000349 |
| Alias | A07:18581351|18582466 |
| Organism | Brassica rapa |
| Position | chrA07: 18581351-18582466 JBrowse» |
| Reference genome | Brassica rapa v2 |
| Type | ie-circRNA |
| Identification method | Find_circ |
| Parent gene | Bra003840 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Bra0A0A3840A:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.141019885 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18582397-18582409(-) |
| Potential amino acid sequence |
MMLDSKAADLDKEERPEILSLLPPIEGETVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKN ENINGHYKNVKFMCADVTSPDMKFSNESMDLIFSNWLLMYLSDKEIQGKSVKSKRITGKSTRWV * |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Wang et al., 2019 |