Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d022276_circ_g.2 |
| ID in PlantcircBase | zma_circ_009483 |
| Alias | Zm07circ00096, GRMZM2G300709_C1 |
| Organism | Zea mays |
| Position | chr7: 174246151-174249807 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d022276 |
| Parent gene annotation |
Kinesin-like protein KIN-12C |
| Parent gene strand | - |
| Alternative splicing | Zm00001d022276_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d022276_T011:4 Zm00001d022276_T001:7 Zm00001d022276_T009:2 Zm00001d022276_T014:4 Zm00001d022276_T013:4 Zm00001d022276_T003:4 Zm00001d022276_T010:4 Zm00001d022276_T008:4 Zm00001d022276_T004:2 Zm00001d022276_T012:4 Zm00001d022276_T005:4 Zm00001d022276_T002:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.098173633 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
174249775-174249801(-) |
| Potential amino acid sequence |
MLLTEISLLRNHFLHILEQKYTTTRKEVEPQGDELIKELDSCRKELDACLENNVLLARYGGKWH KRGGTRSNHVEWVVMDRAERSRKAVNAGAEGTPTGRGEAEGAPTMNSTSRDRERKARQPKLEGG PKGQMYIGEVNKLRCELIQYQKACTNQAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |