Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d022276_circ_g.2 |
ID in PlantcircBase | zma_circ_009483 |
Alias | Zm07circ00096, GRMZM2G300709_C1 |
Organism | Zea mays |
Position | chr7: 174246151-174249807 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d022276 |
Parent gene annotation |
Kinesin-like protein KIN-12C |
Parent gene strand | - |
Alternative splicing | Zm00001d022276_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d022276_T011:4 Zm00001d022276_T001:7 Zm00001d022276_T009:2 Zm00001d022276_T014:4 Zm00001d022276_T013:4 Zm00001d022276_T003:4 Zm00001d022276_T010:4 Zm00001d022276_T008:4 Zm00001d022276_T004:2 Zm00001d022276_T012:4 Zm00001d022276_T005:4 Zm00001d022276_T002:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.098173633 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
174249775-174249801(-) |
Potential amino acid sequence |
MLLTEISLLRNHFLHILEQKYTTTRKEVEPQGDELIKELDSCRKELDACLENNVLLARYGGKWH KRGGTRSNHVEWVVMDRAERSRKAVNAGAEGTPTGRGEAEGAPTMNSTSRDRERKARQPKLEGG PKGQMYIGEVNKLRCELIQYQKACTNQAS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |