Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0609800_circ_g.2 |
| ID in PlantcircBase | osa_circ_012258 |
| Alias | Os_ciR7463 |
| Organism | Oryza sativa |
| Position | chr12: 25755662-25756546 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os12g0609800 |
| Parent gene annotation |
WD40/YVTN repeat-like domain containing protein. (Os12t0609800-0 1);Similar to predicted protein. (Os12t0609800-02) |
| Parent gene strand | + |
| Alternative splicing | Os12g0609800_circ_g.1 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0609800-01:3 Os12t0609800-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.263180923 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25755673-25755664(+) 25755899-25756537(-) |
| Potential amino acid sequence |
MTAATFSSDGSVLAVAAENVVTLWDPDNNTLVGVIAEALSPITKLSFIGTSPFLMSLSQSSKPQ VAMWNVPNLSMQWSYSLFAEAACCSSSRSEFAVLALLSCPDGETLAEQDGVILLFDAENPKPVS SWSVKKE*(+) MNESFVMGDSASAITPTSVLLSGSHNVTTFSAATARTDPSLEKVAAVIGLFLLY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |