Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0609800_circ_g.2 |
ID in PlantcircBase | osa_circ_012258 |
Alias | Os_ciR7463 |
Organism | Oryza sativa |
Position | chr12: 25755662-25756546 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os12g0609800 |
Parent gene annotation |
WD40/YVTN repeat-like domain containing protein. (Os12t0609800-0 1);Similar to predicted protein. (Os12t0609800-02) |
Parent gene strand | + |
Alternative splicing | Os12g0609800_circ_g.1 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0609800-01:3 Os12t0609800-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.263180923 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25755673-25755664(+) 25755899-25756537(-) |
Potential amino acid sequence |
MTAATFSSDGSVLAVAAENVVTLWDPDNNTLVGVIAEALSPITKLSFIGTSPFLMSLSQSSKPQ VAMWNVPNLSMQWSYSLFAEAACCSSSRSEFAVLALLSCPDGETLAEQDGVILLFDAENPKPVS SWSVKKE*(+) MNESFVMGDSASAITPTSVLLSGSHNVTTFSAATARTDPSLEKVAAVIGLFLLY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |