Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G52140_circ_g.14 |
ID in PlantcircBase | ath_circ_027103 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 19336968-19337195 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT3G52140 |
Parent gene annotation |
Clustered mitochondria protein homolog |
Parent gene strand | + |
Alternative splicing | AT3G52140_circ_g.7 AT3G52140_circ_g.8 AT3G52140_circ_g.9 AT3G52140_circ_g.10 AT3G52140_circ_g.11 AT3G52140_circ_g.12 AT3G52140_circ_g.13 AT3G52140_circ_g.15 AT3G52140_circ_g.16 AT3G52140_circ_g.17 AT3G52140_circ_g.18 AT3G52140_circ_g.19 AT3G52140_circ_g.20 AT3G52140_circ_g.21 AT3G52140_circ_g.22 AT3G52140_circ_g.23 AT3G52140_circ_g.24 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G52140.2:1 AT3G52140.1:1 AT3G52140.3:1 AT3G52140.4:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.27229039 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19337106-19337192(+) |
Potential amino acid sequence |
MRVTPRDANYTGPESRFCVLRPELITSFCQVLEAAKLLHIKEHSVIDASETVFKLAAPVECKGI VGSDNRHYLLDLMRVTPRDANYTGPESRFCVLRPELITSFCQVLEAAKLLHIKEHSVIDASETV FKLAAPVECKGIVGSDNRHYLLDLMRVTPRDANYTGPESRFCVLRPELITSFCQVLEAAKLLHI KEHSVIDASETVFKLAAPVECKGIVGSDNRHYLLDLMRVTPRDANYTGPESRFCVLRPELITSF CQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |