Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G15540_circ_g.10 |
| ID in PlantcircBase | ath_circ_038427 |
| Alias | AT5G15540_C2, AT5G15540_C2 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 5055468-5055721 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT5G15540 |
| Parent gene annotation |
Sister chromatid cohesion protein SCC2 |
| Parent gene strand | - |
| Alternative splicing | AT5G15540_circ_g.11 AT5G15540_circ_g.12 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G15540.2:1 AT5G15540.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.409926424 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5055697-5055598(-) |
| Potential amino acid sequence |
MLEDFCGRAEVPGDDRDEAEWSSVPVDEVRVLINELMTIRSKMLLHMVPVDILSRLLRTLDHQI HRAEGLSIYSEHSPSYKTFVRCWRTSVAELKSLVMIGMKQSGHQCPLMKFVFL* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |