Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G15540_circ_g.10 |
ID in PlantcircBase | ath_circ_038427 |
Alias | AT5G15540_C2, AT5G15540_C2 |
Organism | Arabidpsis thaliana |
Position | chr5: 5055468-5055721 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT5G15540 |
Parent gene annotation |
Sister chromatid cohesion protein SCC2 |
Parent gene strand | - |
Alternative splicing | AT5G15540_circ_g.11 AT5G15540_circ_g.12 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G15540.2:1 AT5G15540.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.409926424 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5055697-5055598(-) |
Potential amino acid sequence |
MLEDFCGRAEVPGDDRDEAEWSSVPVDEVRVLINELMTIRSKMLLHMVPVDILSRLLRTLDHQI HRAEGLSIYSEHSPSYKTFVRCWRTSVAELKSLVMIGMKQSGHQCPLMKFVFL* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |