Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G28540_circ_g.4 |
ID in PlantcircBase | ath_circ_033350 |
Alias | At_ciR3897 |
Organism | Arabidpsis thaliana |
Position | chr4: 14108604-14109154 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT4G28540 |
Parent gene annotation |
Casein kinase 1-like protein 6 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G28540.1:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.245322174 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14108965-14109151(+) |
Potential amino acid sequence |
MYFLRGSLPWQGLKAGTKKQKYDRISEKKVSTPIEVYIIDFGLAKKYRDLQTHRHIPYRENKNL TGTARYASVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDRISEKKVSTPI EVYIIDFGLAKKYRDLQTHRHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLESLGYVLMYFL RGSLPWQGLKAGTKKQKYDRISEKKVSTPIEVYIIDFGLAKKYRDLQTHRHIPYRENKNLTGTA RYASVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDRISEKKVSTPIE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |