Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0899500_circ_g.2 |
ID in PlantcircBase | osa_circ_005275 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 39131342-39133372 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0899500 |
Parent gene annotation |
Hypothetical conserved gene. (Os01t0899500-01);FMN-binding split barrel-related domain containing protein. (Os01t0899500-02) |
Parent gene strand | - |
Alternative splicing | Os01g0899500_circ_g.1 Os01g0899500_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0899500-01:3 Os01t0899500-02:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.122266523 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39133309-39131387(+) 39132452-39133328(-) 39131385-39133222(-) |
Potential amino acid sequence |
MVPGLLSARKVGLIQKYFGIENSPIRRITITIALTMK*(+) MDGPIIGETSVVTSDFSDYMDVENFIDMPDENDSKIDTEITDILIEWGMPATMRAIHPIYFAKC LTKAVHDKHREKMDSPSNGVSIVGYLRPAFIEEESYLRSLFHGECNGDGYSSDWRVFDAEILLD QSNLPG*(-) MVSAMVMVIRLIGEFSMPKYFWINPTFLADNRPGTIFFQSSSGCRLLRFCSRFKVHKRSGLPSS *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |